Protein coding transcript 71763

• Transcript: Ll_transcript_484805
• CDS coordinates: 109-471 (+)
• Peptide sequence: MHDFCFTIPYGLVLVFGGIIGYINKGSIASLSGGAVSGFILIFASYLSLNAFRNRKNSYFAITLETIVAAILTWVMGQRYIQTSKVMPAGVVAGISALMTLFYLFKLATGGNHLPPPKAE*
• ORF Type: complete

Annotations of Ll_transcript_484805

• Blastp: Protein FATTY ACID EXPORT 5 from Arabidopsis with 64.17% of identity
• Blastx: Protein FATTY ACID EXPORT 5 from Arabidopsis with 64.17% of identity
• Eggnog: Transmembrane protein 14A(ENOG4112205)
• Kegg: Link to kegg annotations (AT1G50740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435534.1)
• Pfam: Transmembrane proteins 14C (PF03647.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;