Protein coding transcript 72215

• Transcript: Ll_transcript_353870
• CDS coordinates: 3-392 (+)
• Peptide sequence: ALVDMERAFVPPQHFIRLVQRRMERQRREEELKGRSSKKGQDAEQSLLNRATSPLTGGSMKSTKEDKKEKEKDKSGQAEKEGQEGPALKTAGPEGEITAGFLLKKSAKTDGWSRRWFVLNEKTGKVCNC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_353870

• Blastp: Dynamin-2B from Arabidopsis with 77.27% of identity
• Blastx: Dynamin-2B from Arabidopsis with 77.27% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (AT1G59610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413444.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;