Protein coding transcript 73596

• Transcript: Ll_transcript_406678
• CDS coordinates: 747-1130 (+)
• Peptide sequence: MLPSEEAFAAAVSALGIQNKDDLVVYDGKGLFSAARVWWMFRVFGHDRVWVLDGGLPRWRASGYDVESSASSDAILKASAATEAIEKTYQGLSVGPITFQTKFQPHLVWNLDQVHCNFYYCHFKCKV*
• ORF Type: complete

Annotations of Ll_transcript_406678

• Blastp: Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial from Arabidopsis with 78.29% of identity
• Blastx: Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial from Arabidopsis with 83.06% of identity
• Eggnog: sulfurtransferase(COG2897)
• Kegg: Link to kegg annotations (AT1G79230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455759.1)
• Pfam: Rhodanese-like domain (PF00581.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;