Protein coding transcript 73600

• Transcript: Ll_transcript_406688
• CDS coordinates: 1079-1627 (+)
• Peptide sequence: MLPSEEAFAAAVSALGIQNKDDLVVYDGKGLFSAARVWWMFRVFGHDRVWVLDGGLPRWRASGYDVESSASSDAILKASAATEAIEKTYQGLSVGPITFQTKFQPHLVWNLDQVKRNIEEKSHQHIDARSKPRFDGAAPEPRKGIRSGHVPGSKCIPFGQVHHILVMSICIFTEFIYFTSYS*
• ORF Type: complete

Annotations of Ll_transcript_406688

• Blastp: Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial from Arabidopsis with 83.23% of identity
• Blastx: Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial from Arabidopsis with 83.54% of identity
• Eggnog: sulfurtransferase(COG2897)
• Kegg: Link to kegg annotations (AT1G79230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443713.1)
• Pfam: Rhodanese-like domain (PF00581.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;