Protein coding transcript 73698

• Transcript: Ll_transcript_407049
• CDS coordinates: 101-1102 (+)
• Peptide sequence: MDEKEHNQDHNHPSLVPNHNTTNTITPKKESLRKPIIGGDRLKRDEWSEGAVSTLLEAYEAKWVLRNRAKLKGQDWEDVAKYVSSRANSTKSPKTQTQCKNKIESMKKRYRSESATSDASTWPLYSRLDLLLRGTGPISSVLPPPPIVAAPSQSLYPTNNNQALMLLEPSLAVSQPPPPAAPPPHATAQNSHGSNGVDRLAKEDGLGTKSSDQVSNKNPLDTDSSTPALYSEKENIRCNNKKKMKMDSNKRQRKEHMDIAESLRWLAEVVLRSEQTRMDTMKEIERMRVEAEAKRSEMDLKRTEIIANTQLEIAKIFASVNKGVDSSLRIGRS*
• ORF Type: complete

Annotations of Ll_transcript_407049

• Blastp: Trihelix transcription factor ASIL2 from Arabidopsis with 24.48% of identity
• Blastx: Trihelix transcription factor ASIL2 from Arabidopsis with 37.74% of identity
• Eggnog: NA(ENOG410Z419)
• Kegg: Link to kegg annotations (AT3G14180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427397.1)
• Pfam: Myb/SANT-like DNA-binding domain (PF13837.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;