Protein coding transcript 74304

• Transcript: Ll_transcript_405408
• CDS coordinates: 114-554 (+)
• Peptide sequence: MAQPPALEQVQCFGRKKTAVAVTYCKRGRGLIKINGSPIELVEPEILRFKAFEPILLLGKSRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR*
• ORF Type: complete

Annotations of Ll_transcript_405408

• Blastp: 40S ribosomal protein S16 from Gossypium with 93.62% of identity
• Blastx: 40S ribosomal protein S16 from Gossypium with 93.62% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424313.1)
• Pfam: Ribosomal protein S9/S16 (PF00380.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;