Protein coding transcript 7600

• Transcript: Ll_transcript_494959
• CDS coordinates: 145-717 (+)
• Peptide sequence: MPSLCIFTPFPSLQNPNFHHTHFFNSPITSHLHFSLTKIHFHRKIHCNALKDSSEEIKAVLGSDGGGGGDGGDGGNDGDGDRSKKVEKKDGSLPDWLNFTSDDAKTVFAALAISLAFRTFVAEPRYIPSLSMYPTFDVGDRLVAEKVLFLLLKLVTFFLVFVVNVNLSHEKILEWKMEVMWVLERKKMGK*
• ORF Type: complete

Annotations of Ll_transcript_494959

• Blastp: Chloroplast processing peptidase from Arabidopsis with 49.32% of identity
• Blastx: Chloroplast processing peptidase from Arabidopsis with 66.29% of identity
• Eggnog: Signal peptidase i(COG0681)
• Kegg: Link to kegg annotations (AT3G24590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422133.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;