Transcript | Ll_transcript_494919 |
---|---|
CDS coordinates | 1364-2101 (+) |
Peptide sequence | MQLKRKYLIVCLSIQLFEQVDDVTADYIISQLLFLDAEDPKKDITLFINSPGGSVTAGMGIYDAMKLCKADVSTVCLGLAASMGAFILASGTKGKRYCMPNSRVMIHQPLGTAGGKATEMSIRIREMAYHKIKINKILSRVTGKPEEQVEVDTDRDNFMNPWEAKEYGLIDGVIDDGKPGLVAPIADASPPPRTRVWDQWKVEGSRKARKNFPSEHKFLHNADKGGEGSGDDNGTGQEEEAPAAV* |
ORF Type | complete |
Blastp | ATP-dependent Clp protease proteolytic subunit 3, chloroplastic from Arabidopsis with 78.85% of identity |
---|---|
Blastx | ATP-dependent Clp protease proteolytic subunit 3, chloroplastic from Arabidopsis with 67.57% of identity |
Eggnog | Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity)(COG0740) |
Kegg | Link to kegg annotations (AT1G66670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453049.1) |
Pfam | Clp protease (PF00574.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer