Protein coding transcript 78385

• Transcript: Ll_transcript_342458
• CDS coordinates: 1866-2345 (+)
• Peptide sequence: MNERKVTAPGSPANSLLSDLRLRSIIENARQMCKVMEEFGSFDTYIWNFVSHKPIVSQFRYPRQVPVKSPKAEFISKDLVKRGFRSVGPTVIYTFMQVAGLTNDHLISCFRFKECSAANAEAVAEESSLNSEVKEKASEEEPSEVGILLAVNKLSFTSK*
• ORF Type: complete

Annotations of Ll_transcript_342458

• Blastp: Probable GMP synthase [glutamine-hydrolyzing] from Helicobacter with 47.25% of identity
• Blastx: Probable GMP synthase [glutamine-hydrolyzing] from Helicobacter with 41.6% of identity
• Eggnog: Catalyzes the synthesis of GMP from XMP (By similarity)(COG0518)
• Kegg: Link to kegg annotations (HH_1444)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427103.1)
• Pfam: Methyladenine glycosylase (PF03352.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;