Protein coding transcript 81692

• Transcript: Ll_transcript_532539
• CDS coordinates: 70-528 (+)
• Peptide sequence: MASGEDENGEFYLRYYVGHKGKFGHEFLEFEFRSDGKLRYANNSNYKNDTIIRKEVYLTPAVLRECRRIISQSEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSKIGSLMDVQNSADPEGLRIFYYLVQDLKCFVFSLISLHFKIKPI*
• ORF Type: complete

Annotations of Ll_transcript_532539

• Blastp: Protein mago nashi homolog 2 from Oryza sativa with 88.24% of identity
• Blastx: Protein mago nashi homolog 2 from Oryza sativa with 88.24% of identity
• Eggnog: Mago nashi(ENOG4111FJ7)
• Kegg: Link to kegg annotations (4351998)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455450.1)
• Pfam: Mago nashi protein (PF02792.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;