Protein coding transcript 87711

• Transcript: Ll_transcript_489537
• CDS coordinates: 657-1253 (+)
• Peptide sequence: MHHEGLPYVALSGENSSQVEIWDLKSAERFVQLPSNITSNSSSVCNKDRGMCMALQLFSPSESRGFLNVLAGYEDGSMLWWDVRNPRVPLTSVKFHSEPVLSICIDGSCNGGISGAADDKIVMYSLEHSTGTCVFKKEISLERPGISGSSIRPDGKIAATAGWDHRIRIYNYRKGNALAILKYHRATVSHCFLYLIHM*
• ORF Type: complete

Annotations of Ll_transcript_489537

• Blastp: Protein DECREASED SIZE EXCLUSION LIMIT 1 from Arabidopsis with 68.82% of identity
• Blastx: Protein DECREASED SIZE EXCLUSION LIMIT 1 from Nicotiana with 53.67% of identity
• Eggnog: wd repeat(COG2319)
• Kegg: Link to kegg annotations (AT4G29860)
• CantataDB: Link to cantataDB annotations (CNT0001698)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416003.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;