Protein coding transcript 88062

• Transcript: Ll_transcript_346686
• CDS coordinates: 219-863 (+)
• Peptide sequence: MAATRARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIKNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVDEVFFSIARDIKQRLADTDSKAEPQALKINQSDQGSGSAQAGQKSACCGS*
• ORF Type: complete

Annotations of Ll_transcript_346686

• Blastp: Ras-related protein RABE1a from Arabidopsis with 92.72% of identity
• Blastx: Ras-related protein RABE1a from Arabidopsis with 92.72% of identity
• Eggnog: member RAS oncogene family(ENOG410XPUI)
• Kegg: Link to kegg annotations (AT3G53610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430800.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;