Protein coding transcript 89395

• Transcript: Ll_transcript_346894
• CDS coordinates: 446-805 (+)
• Peptide sequence: MLMNLKTLDWDASTLQELGIPAEILPKIVSNAEVIGNVAAGWPFTGVPIAGCLGDQHAAMLGQACSRGEAKSTYGTGAFILMNTGEEIVKSAHGLLTTVAFKLGKEAKTIYALEGSVAIA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_346894

• Blastp: Glycerol kinase from Arabidopsis with 76.67% of identity
• Blastx: Glycerol kinase from Arabidopsis with 78.11% of identity
• Eggnog: Key enzyme in the regulation of glycerol uptake and metabolism (By similarity)(COG0554)
• Kegg: Link to kegg annotations (AT1G80460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443350.1)
• Pfam: FGGY family of carbohydrate kinases, N-terminal domain (PF00370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;