Protein coding transcript 9477

• Transcript: Ll_transcript_334598
• CDS coordinates: 260-670 (+)
• Peptide sequence: MFTAIIQSTATVMHLRLLRNAAVSSNYFFNHSRPLRNMKPIRVSMSSLPPSDPFEICVKASVTTPNRIGDCKQFLNLFLCSFLQFNVMRSLLQLLSDTSRYSTIKCPFCQRVLLTLEEKHLPYDLKLVDLANKPEW*
• ORF Type: complete

Annotations of Ll_transcript_334598

• Blastp: Glutathione S-transferase DHAR3, chloroplastic from Arabidopsis with 42% of identity
• Blastx: Glutathione S-transferase DHAR3, chloroplastic from Arabidopsis with 36.48% of identity
• Eggnog: Chloride intracellular channel(ENOG4110FKA)
• Kegg: Link to kegg annotations (AT5G16710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459154.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF13417.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;