Protein coding transcript 96430

• Transcript: Ll_transcript_515331
• CDS coordinates: 709-1089 (+)
• Peptide sequence: MAMSVTQHRESNSSGGSSIDKHLDSSKYVRYTAEQVEALERVYLECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLHTVNRKLSALNKLLMEENNRLQKQVSQLVCENGYM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_515331

• Blastp: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 82.81% of identity
• Blastx: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 82.81% of identity
• Eggnog: Homeobox-leucine zipper protein(ENOG410ZJBV)
• Kegg: Link to kegg annotations (AT5G60690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447870.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;