Protein coding transcript 9658

• Transcript: Ll_transcript_358455
• CDS coordinates: 102-1109 (+)
• Peptide sequence: MSSKTQILIFLLSLFTFSSIIDPSLGSTGGIAIYWGQNNGDGSLTETCDSNKYEIVLLAFLVQFGGGREVKWNFAGHCGDWNPCTQLEPEIKHCQAKGVKVLLSLGGAPSDPPKYGLSSAQDAKNVAKYLNDNFLSGQYGPLGSVTLDGIDFDIEVTDLYWDDLARELDIFRQSRYFYLSAAPQCPTEPYIYYLQKAIQTGLFDYIFIQFYNNGQCEYSTSAGTSLLLQSWDKWASLVKSNNSIFLGLPANVTAAGTGYIAPETVISDVLPHIKQTPNYGGVMLWDRYRDKEADFSGKILPYVSKSNVLLQTVTAVWEGLFEGVSAALHSIKASQ*
• ORF Type: complete

Annotations of Ll_transcript_358455

• Blastp: Acidic endochitinase from Vitis with 51.1% of identity
• Blastx: Acidic endochitinase from Vitis with 51.1% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100233088)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452773.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;