Transcript | Ll_transcript_388600 |
---|---|
CDS coordinates | 391-1176 (+) |
Peptide sequence | MVSAAMMIQDQSGVSGSQSGPPEGDEVSMSSGLHSVAHFQLNDQFSRGNDYAPKVRKPYTITKQRERWTNEEHTKFLEALKLYGRAWRRIEEHVATKTAVQIRSHAQKFFSKVLHDSSGNIKNSVEPIEIPPPRPKRKPMHPYPRKLVMSPNKEISILDQPMRSISLKSSDFDQENQTPKSVLFAHGSDSSLGSSDSDTPNGSLSPMSSIGGVHKTAFSLSEQKTTFEEPGLNAYSAHDEKPLVVLLPNQFHYIDLLTRIA* |
ORF Type | complete |
Blastp | Protein REVEILLE 1 from Arabidopsis with 64.53% of identity |
---|---|
Blastx | Protein REVEILLE 1 from Arabidopsis with 63.37% of identity |
Eggnog | myb-like DNA-binding domain, SHAQKYF class family protein(ENOG41123FA) |
Kegg | Link to kegg annotations (AT5G17300) |
CantataDB | Link to cantataDB annotations (CNT0000037) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439524.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer