Protein coding transcript 97787

• Transcript: Ll_transcript_388600
• CDS coordinates: 391-1176 (+)
• Peptide sequence: MVSAAMMIQDQSGVSGSQSGPPEGDEVSMSSGLHSVAHFQLNDQFSRGNDYAPKVRKPYTITKQRERWTNEEHTKFLEALKLYGRAWRRIEEHVATKTAVQIRSHAQKFFSKVLHDSSGNIKNSVEPIEIPPPRPKRKPMHPYPRKLVMSPNKEISILDQPMRSISLKSSDFDQENQTPKSVLFAHGSDSSLGSSDSDTPNGSLSPMSSIGGVHKTAFSLSEQKTTFEEPGLNAYSAHDEKPLVVLLPNQFHYIDLLTRIA*
• ORF Type: complete

Annotations of Ll_transcript_388600

• Blastp: Protein REVEILLE 1 from Arabidopsis with 64.53% of identity
• Blastx: Protein REVEILLE 1 from Arabidopsis with 63.37% of identity
• Eggnog: myb-like DNA-binding domain, SHAQKYF class family protein(ENOG41123FA)
• Kegg: Link to kegg annotations (AT5G17300)
• CantataDB: Link to cantataDB annotations (CNT0000037)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439524.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;