Protein coding transcript 100

• Transcript: Ll_transcript_389840
• CDS coordinates: 3-746 (+)
• Peptide sequence: SFITMDYATWYHCCVHKRQQLQNLKLADSFQIEVNFFIRYYLPIDDPNSHPLIIDTVPFIQTSFTLLCKHIFEINHKDFLRRNLANSLYATLLTYASPQDIENISCEIIAQLRELYISHASNPGSTKSSDLRGESFDFDVNVSIDIPINTSDEELDVQEQLSMQEDVKMVPASDKDVQSLKTYKLPQQCQICLEKFYGEKEDDDDVEITTMPCGHVFHSQCIIQWLQTSHMCPLCRCPLSTDNKRKR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_389840

• Blastp: E3 ubiquitin-protein ligase RING1-like from Arabidopsis with 34.57% of identity
• Blastx: E3 ubiquitin-protein ligase RING1-like from Arabidopsis with 34.57% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT3G19950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447189.1)
• Pfam: Anaphase-promoting complex subunit 11 RING-H2 finger (PF12861.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;