Transcript | Ll_transcript_341043 |
---|---|
CDS coordinates | 62-595 (+) |
Peptide sequence | MGKEDKETWKSNYFSKLIQLLEEYPKCFIVGADNVGSKQMQQIRVSLRGSAVVLMGKNTMMRKAIRGHIERNQALEKILPHIKGNVGFVFTRGELPEVRDKLLQNKVRAPARAGAIAPCPVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKEGDKVGASEATLLNML |
ORF Type | 3prime_partial |
Blastp | 60S acidic ribosomal protein P0 from Ceratitis with 83.15% of identity |
---|---|
Blastx | 60S acidic ribosomal protein P0 from Ceratitis with 83.15% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003603496.1) |
Pfam | Ribosomal protein L10 (PF00466.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer