Protein coding transcript 1008

• Transcript: Ll_transcript_341023
• CDS coordinates: 28-573 (+)
• Peptide sequence: MLQYPLNQQLRISSDGPVSILWDIENCSVPTDVRPEDVAGNIRMALQVHPVIKGAVMMFSAYGDFNAFPRRLREGCQRTGVKLIDVPNGRKDAADKAILVDMFLFALDNPPPSSIMLISGDVDFAPALHILGQRGYTVILVIPAGVGVSSALCNAGKFVWDWPSVARGEGFVPPSKALLPPR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_341023

• Blastp: Meiosis regulator and mRNA stability factor 1 from Gallus with 30.71% of identity
• Blastx: Meiosis regulator and mRNA stability factor 1 from Gallus with 30.71% of identity
• Eggnog: kiaa0430(ENOG410XQFX)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423417.1)
• Pfam: NYN domain (PF01936.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;