Transcript | Ll_transcript_404966 |
---|---|
CDS coordinates | 41-712 (+) |
Peptide sequence | MRERVLNTLSTEERWVVFVGPHEHHSNLLSWRQSLAEVVEIEVNDKGLLDMDSLKQKLEFYKYTNRPLLGSFSACSNVTGIYSDTRTIAQILHQYRGFACFDFASSGPYVKIDMKSGKSDGYDAVFLSPHKFLGGPDSPGVLLMNKALYQLRSSPPSTCGGGTVSYVNGFSEKDTLYLEDIEERENGGTPPIIQTVRAALAFWVKEYISYEEIEKREELYINKA |
ORF Type | 3prime_partial |
Blastp | Probable cysteine desulfurase from Staphylococcus with 30.05% of identity |
---|---|
Blastx | Probable cysteine desulfurase from Staphylococcus with 30.05% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SA0776) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458888.1) |
Pfam | Aminotransferase class-V (PF00266.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer