Protein coding transcript 1030

• Transcript: Ll_transcript_404966
• CDS coordinates: 41-712 (+)
• Peptide sequence: MRERVLNTLSTEERWVVFVGPHEHHSNLLSWRQSLAEVVEIEVNDKGLLDMDSLKQKLEFYKYTNRPLLGSFSACSNVTGIYSDTRTIAQILHQYRGFACFDFASSGPYVKIDMKSGKSDGYDAVFLSPHKFLGGPDSPGVLLMNKALYQLRSSPPSTCGGGTVSYVNGFSEKDTLYLEDIEERENGGTPPIIQTVRAALAFWVKEYISYEEIEKREELYINKA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_404966

• Blastp: Probable cysteine desulfurase from Staphylococcus with 30.05% of identity
• Blastx: Probable cysteine desulfurase from Staphylococcus with 30.05% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SA0776)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458888.1)
• Pfam: Aminotransferase class-V (PF00266.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;