Protein coding transcript 1054

• Transcript: Ll_transcript_428308
• CDS coordinates: 3-323 (+)
• Peptide sequence: MDKINSLKRKRAGGADLNDKEDNFDVALEDAAVTEKKDRAERKAKGAEAGQNRKRQKKDEKYGFGGKKRHAKSNDAKSSSEMGGFSAKRMKGKPTGGAKRPGKSQRA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_428308

• Blastp: Probable rRNA-processing protein ebp2 from Schizosaccharomyces with 45.13% of identity
• Blastx: Probable rRNA-processing protein ebp2 from Schizosaccharomyces with 45.13% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC17H9.05)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003612737.2)
• Pfam: Eukaryotic rRNA processing protein EBP2 (PF05890.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;