Protein coding transcript 106

• Transcript: Ll_transcript_499561
• CDS coordinates: 1-438 (+)
• Peptide sequence: IAHKDSARGVHFRRAGPRQRVYFESDEVQAAIVTCGGLCPGLNTVIRELVCGLHNMYGVKAVLGINGGYKGFYAHNTITLTPKNVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQRGAAKIFEEITRVSMLT
• ORF Type: internal

Annotations of Ll_transcript_499561

• Blastp: ATP-dependent 6-phosphofructokinase 3 from Arabidopsis with 80.85% of identity
• Blastx: ATP-dependent 6-phosphofructokinase 3 from Arabidopsis with 80.85% of identity
• Eggnog: phosphohexokinase(COG0205)
• Kegg: Link to kegg annotations (AT4G26270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422871.1)
• Pfam: Phosphofructokinase (PF00365.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;