Transcript | Ll_transcript_499561 |
---|---|
CDS coordinates | 1-438 (+) |
Peptide sequence | IAHKDSARGVHFRRAGPRQRVYFESDEVQAAIVTCGGLCPGLNTVIRELVCGLHNMYGVKAVLGINGGYKGFYAHNTITLTPKNVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQRGAAKIFEEITRVSMLT |
ORF Type | internal |
Blastp | ATP-dependent 6-phosphofructokinase 3 from Arabidopsis with 80.85% of identity |
---|---|
Blastx | ATP-dependent 6-phosphofructokinase 3 from Arabidopsis with 80.85% of identity |
Eggnog | phosphohexokinase(COG0205) |
Kegg | Link to kegg annotations (AT4G26270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422871.1) |
Pfam | Phosphofructokinase (PF00365.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer