Transcript | Ll_transcript_299785 |
---|---|
CDS coordinates | 164-685 (+) |
Peptide sequence | MMNNSLSQNSIYIESDDEDEKDLNKGEGEGYDSDSSNYSGENPPQRKPSSYNISWPQSYRHSIDLYSSVPSPNLGFLGTPSLTRLSSSFLSTSLTRRHTPEALHSATKPLIQPTEEEQHKHSSHALLPPLPRRSSSLIKDSKVSHEGPISSHCSFGQAVLNGMYFKHEFLYRF* |
ORF Type | complete |
Blastp | Amino acid transporter AVT1C from Arabidopsis with 53.53% of identity |
---|---|
Blastx | Amino acid transporter AVT1C from Arabidopsis with 53.53% of identity |
Eggnog | amino acid transport(COG0814) |
Kegg | Link to kegg annotations (AT2G39130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459069.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer