Protein coding transcript 106854

• Transcript: Ll_transcript_299785
• CDS coordinates: 164-685 (+)
• Peptide sequence: MMNNSLSQNSIYIESDDEDEKDLNKGEGEGYDSDSSNYSGENPPQRKPSSYNISWPQSYRHSIDLYSSVPSPNLGFLGTPSLTRLSSSFLSTSLTRRHTPEALHSATKPLIQPTEEEQHKHSSHALLPPLPRRSSSLIKDSKVSHEGPISSHCSFGQAVLNGMYFKHEFLYRF*
• ORF Type: complete

Annotations of Ll_transcript_299785

• Blastp: Amino acid transporter AVT1C from Arabidopsis with 53.53% of identity
• Blastx: Amino acid transporter AVT1C from Arabidopsis with 53.53% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT2G39130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459069.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;