| Transcript | Ll_transcript_298883 |
|---|---|
| CDS coordinates | 349-711 (+) |
| Peptide sequence | MYFYYARFSAFVSYRNQAITPKVMLPPLYLEKHSTVSLSPVIGDTPVPVSVEVSNGLMVDEAYGVVGLKLVFLGRLRWKVGAIRTSHYGLYVKCDMLIGLKKGFVGQVPLLGAPPCKVDV* |
| ORF Type | complete |
| Blastp | NDR1/HIN1-like protein 12 from Arabidopsis with 33.98% of identity |
|---|---|
| Blastx | NDR1/HIN1-like protein 12 from Arabidopsis with 33.98% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT2G35960) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019435311.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer