Protein coding transcript 109

• Transcript: Ll_transcript_324721
• CDS coordinates: 1-516 (+)
• Peptide sequence: GAAVATLNAVDIVANGFNKGAPVTTFAFASPRVGDINFMNLASEYKDLRILRIENKFDIVPNYPLIGYHDVGEVFKIVTTKSSFLKVSVNPSNLHNLEIYLHGVAGTQGTNEGFQLEVNRDIALVNKYLDGLKDEYLVPESWWIEKNKGMVQEEDGSWKLMDHEVEEGDSF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_324721

• Blastp: Phospholipase A1-II 1 from Oryza sativa with 56.71% of identity
• Blastx: Phospholipase A1-II 1 from Oryza sativa with 55.69% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107281022)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440209.1)
• Pfam: Lipase (class 3) (PF01764.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;