Protein coding transcript 109223

• Transcript: Ll_transcript_410604
• CDS coordinates: 339-689 (+)
• Peptide sequence: MAPAKQLKIMQEFQKQSAQFDMTAEMMSYAIDDVLDSDEVEEETEELTNQVFGTRMGTEDPCSRKREYTRSFILVHLLVHRRLRPVLLQHKRFSTKNYELQLQYLTPRFLCTLHTP*
• ORF Type: complete

Annotations of Ll_transcript_410604

• Blastp: Vacuolar protein sorting-associated protein 2 homolog 3 from Arabidopsis with 73.08% of identity
• Blastx: Vacuolar protein sorting-associated protein 2 homolog 2 from Arabidopsis with 70.37% of identity
• Eggnog: Charged multivesicular body protein(COG5491)
• Kegg: Link to kegg annotations (AT1G03950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426723.1)
• Pfam: Snf7 (PF03357.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;