Transcript | Ll_transcript_329379 |
---|---|
CDS coordinates | 30-302 (+) |
Peptide sequence | MASSANQQQPFPAVPPSMSAGDSHEMRDYYPSQDAPRPTINQTPNFKPYLGLRARLSQIWINRWTILLLLVLVRLLIAIASTDSSLVSARR |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | Plasma membrane fusion protein prm1 from Aspergillus with 72% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AN5614.2) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020212929.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer