Protein coding transcript 113201

• Transcript: Ll_transcript_397304
• CDS coordinates: 39-326 (+)
• Peptide sequence: MSWKDVYSSAVRWRQIAEPCDPVLWVNKLSEEFNSGFGSHKSMILGQAKVVRYFPNYERTLYILKTVMKERSYVHSRKDEIIDLSQDGKLEEVSS*
• ORF Type: complete

Annotations of Ll_transcript_397304

• Blastp: Suppressor of RPS4-RLD 1 from Arabidopsis with 70.97% of identity
• Blastx: Suppressor of RPS4-RLD 1 from Arabidopsis with 70.97% of identity
• Eggnog: repeat-containing protein(COG0457)
• Kegg: Link to kegg annotations (AT4G37460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446848.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;