Transcript | Ll_transcript_397034 |
---|---|
CDS coordinates | 2243-2671 (+) |
Peptide sequence | MPLGTAIHNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNKYSDNLILRRRSK* |
ORF Type | complete |
Blastp | 50S ribosomal protein L2, chloroplastic from Carica with 100% of identity |
---|---|
Blastx | 30S ribosomal protein S3, chloroplastic from Lotus with 89.81% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002678) |
Mirbase | osa-MIR5538 (MI0019059) |
Ncbi protein | Link to NCBI protein (YP_008963639.1) |
Pfam | Ribosomal Proteins L2, C-terminal domain (PF03947.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer