Protein coding transcript 115

• Transcript: Ll_transcript_470379
• CDS coordinates: 2-523 (+)
• Peptide sequence: KSLRYLDAHFNELHGLPIAFGKLSNLEFLNLSSNFSDLKELPETFGDLISLRELDLSNNQIHLLPDTFGRLHSLSKLNLDQNPIELPPSEIVKQGVVAIKGFMAKRWMDMLAEEERKSTQELQGQEEGQNGWLTRSTSWLKNVSVNAADYVGTAIKETMSPRTPKDAFLDQQL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_470379

• Blastp: Plant intracellular Ras-group-related LRR protein 1 from Arabidopsis with 58.38% of identity
• Blastx: Plant intracellular Ras-group-related LRR protein 1 from Arabidopsis with 58.96% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G05850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463827.1)
• Pfam: Leucine Rich repeats (2 copies) (PF12799.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;