Protein coding transcript 1155

• Transcript: Ll_transcript_494631
• CDS coordinates: 68-607 (+)
• Peptide sequence: MCHVIAGILLGPSGLGRSPKYWNVLFPPRQAGFLQLSSLIGALYYIFIVTLKMDITTTLRASKNTWRLGVIPYLSSFIVITTLLCFYSVYEHNPHVQNPAVRTFIGVSMSFSYFPVISDALMEFNLIATEVGQIALCSAMLNDILQWLIVVTRRVISAGSIRSSFMIFNIQLLSLFFCIF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_494631

• Blastp: Cation/H(+) antiporter 15 from Arabidopsis with 32.48% of identity
• Blastx: Cation/H(+) antiporter 15 from Arabidopsis with 32.48% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT2G13620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437573.1)
• Pfam: Sodium/hydrogen exchanger family (PF00999.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;