Protein coding transcript 1161

• Transcript: Ll_transcript_322195
• CDS coordinates: 22-627 (+)
• Peptide sequence: MGAYKYIQELYRKKQSDVMRFLLRIRVWQFRQLTKMHRSPRPSRPDKARRIGYRSKHGYAVFRIRVRRGGRKKPVPKGATYGKPKSQGVNQLKPARNLQSVAEERVGRRVGGLRVLNSYWVAEDSTYKYYEVICVDPFHKAIRRDPKANWICKPVMKHRELRGLTSAGRKARGLGKGHRYSQTIGGSRRACWRRKNTLSLRR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_322195

• Blastp: 60S ribosomal protein L15 from Chironomus with 79.21% of identity
• Blastx: 60S ribosomal protein L15 from Chironomus with 79.21% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004512167.1)
• Pfam: Ribosomal L15 (PF00827.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;