Transcript | Ll_transcript_322219 |
---|---|
CDS coordinates | 17-388 (+) |
Peptide sequence | MGKIMKANRVVLVLNGRYAGRKAIVLKSYDEGTQDKQYGHALVAGIDRYPRKVHKRMSKAKIKKRSKIKPFLKVMNYNHLLPTRYTVADIVPEQKVTPKDLKDPMKKKKARFWVRCKLEEKYKA |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | 60S ribosomal protein L27 from Canis with 58.87% of identity |
Eggnog | (ribosomal) protein(COG2163) |
Kegg | Link to kegg annotations (403688) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020221499.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer