Protein coding transcript 118

• Transcript: Ll_transcript_470375
• CDS coordinates: 1-411 (+)
• Peptide sequence: VASGSIVWSANRDNPISEYGIMNLTINGIVIVDEGGDVKWSTPPLKSLVDKLVLTEMGNLVLLDQSNVSLWESFQYPTDTIVIGQRLPIGTWLSSAASDSDLSYGNYNLTITASDAILQWHGQVYWKLSMDTKTYKN
• ORF Type: internal

Annotations of Ll_transcript_470375

• Blastp: G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370 from Arabidopsis with 53.33% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370 from Arabidopsis with 53.33% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G35370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433155.1)
• Pfam: D-mannose binding lectin (PF01453.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;