Protein coding transcript 118040

• Transcript: Ll_transcript_305905
• CDS coordinates: 185-649 (+)
• Peptide sequence: METLDNMFVSNWSNVRSSVPPSYIQPIENRPGNVISSSCKAIPVIDFGGHDRDYIAKYILKASEEFGFFQVINHGVCKDLMDEAVNIFKEFHAMPPKEKVNEGSRDPNGRCKFYTSSENYKKDAVHYWKDTLTHSCPPSEEVIQYWPQKPPKYR*
• ORF Type: complete

Annotations of Ll_transcript_305905

• Blastp: Protein DOWNY MILDEW RESISTANCE 6 from Arabidopsis with 37.68% of identity
• Blastx: Protein DOWNY MILDEW RESISTANCE 6 from Arabidopsis with 37.24% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT5G24530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442746.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;