Protein coding transcript 122140

• Transcript: Ll_transcript_349310
• CDS coordinates: 733-2184 (+)
• Peptide sequence: MCERALVSADPIVTSLGEFQQADVYYSESGDCAAFISNHDSNSSVRVLFNNMHYTLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTSNQMFLWESVDEDITSMDDSAVTAPGLLEQINVTRDTSDYLWYITSVDIGSSESFLRGGETPTLVVQSTGHAVHVFINGQLSGSAFGTREYRRFKYSDKVNLRAGTNRIALLSVAVGLPNVGGRYETWSTGILGPVEIHGLDQGNWDLSWQKWTYQVGLKGEAMNLVSPNGISSVQWMQSAIVIKRNQPLTWHKTYFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNCNGCNYAGGFRPPKCQFGCGQPTQRWYHVPRSWLKPTQNLLVIFEELEGNPSRISLVKRSVGSVCADVSEYHPNIKNRHIESYGNAAKFHPAKAHLHCSPGQIISSIKFASFGTPFGTCGNYKQGACHSPTSYAILEKVIFITLYFTIPFIKFMACRI*
• ORF Type: complete

Annotations of Ll_transcript_349310

• Blastp: Beta-galactosidase 3 from Arabidopsis with 74.57% of identity
• Blastx: Beta-galactosidase 3 from Arabidopsis with 75.14% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT4G36360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446869.1)
• Pfam: Galactose binding lectin domain (PF02140.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;