Transcript | Ll_transcript_507594 |
---|---|
CDS coordinates | 3-695 (+) |
Peptide sequence | EKGAVQRERDHLLAEVENLAANSDGQTQKLEDIHAHKLKALEAQIMDLKKKQESQVQLMKQKQKSDEAAKRLQDEIQSIKAQKVQLQQRIKQEAEQFRQWKASREKELLQLRKEGRRNEYERHKLQALNQRQKMVLQRKTEEAAMATKRLKELLEARKTSSRDTLVTMNGCGTNGQNNEKSLLRWLDHELEVMIKEHEVRFEYEKQSQVRAVLAEELAMLKQVNEFTAKGL |
ORF Type | internal |
Blastp | Kinesin-like protein KIN-4A from Gossypium with 82.61% of identity |
---|---|
Blastx | Kinesin-like protein KIN-4A from Gossypium with 82.61% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (107917911) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415055.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer