Protein coding transcript 124397

• Transcript: Ll_transcript_463821
• CDS coordinates: 312-1130 (+)
• Peptide sequence: MIQVSPTYIFWLKQCMSYTDMCYHMHLLTTLIYVPIDAFYVANEALCYGITSYMTMNDASNLLRKIISHEPSSNKFLLEITCLLNLSKVANEKVVVRDSSGKEIQSQLLPILDEFLGVRNYHTKAYLGVSSTVNPKYWLAFSATVPALGFSTYYVSKAKQPATISDTNTAYKSRNQSDTIKVGIGNLKLIYSKKEGKLTQYINSRSKVKESVEQAYKFYAGYGDDGTQNAQASGAYVFRPNGSSSPIKSHREVKSSINTLDIQLPILSGSKD*
• ORF Type: complete

Annotations of Ll_transcript_463821

• Blastp: Probable alpha-mannosidase At5g13980 from Arabidopsis with 37.16% of identity
• Blastx: Probable alpha-mannosidase At5g13980 from Arabidopsis with 37.16% of identity
• Eggnog: Mannosidase alpha class(ENOG410XQMZ)
• Kegg: Link to kegg annotations (AT5G13980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430110.1)
• Pfam: Glycosyl hydrolases family 38 C-terminal domain (PF07748.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;