Protein coding transcript 1248

• Transcript: Ll_transcript_495741
• CDS coordinates: 37-432 (+)
• Peptide sequence: MVDDAQSNRPHKIDGRTVETKRAVPRNDIGRPEAGATVKKVFIGGLKDDINEEELRTYFQEFGPISNVAIIMDRDTGKKRGFGFVEFEDYDAVDKICLQGSHMINGKRIDVKKAIGKDAGKDRGGDRMDRSS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_495741

• Blastp: Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog from Schistocerca with 64.96% of identity
• Blastx: Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog from Schistocerca with 66.67% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456443.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;