Transcript | Ll_transcript_495741 |
---|---|
CDS coordinates | 37-432 (+) |
Peptide sequence | MVDDAQSNRPHKIDGRTVETKRAVPRNDIGRPEAGATVKKVFIGGLKDDINEEELRTYFQEFGPISNVAIIMDRDTGKKRGFGFVEFEDYDAVDKICLQGSHMINGKRIDVKKAIGKDAGKDRGGDRMDRSS |
ORF Type | 3prime_partial |
Blastp | Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog from Schistocerca with 64.96% of identity |
---|---|
Blastx | Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog from Schistocerca with 66.67% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456443.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer