Protein coding transcript 124902

• Transcript: Ll_transcript_463051
• CDS coordinates: 1033-1788 (+)
• Peptide sequence: MKNEVVAAVGPQSSGIAHVVSHVANELHVPLLSFGATDPTLSALQYPYFIRTTQSDYYQMHAIADFIEYHGWREVIAIFVDDDNGRNGVTALGDALSKKRSRISYKAAFPPEASQSYISDLLNEVNLMESRVYVLHVNPDSGLTIFSIAKKLRMMSTGYVWIATDWLPSMLDSLVRADTGTMNILQGVVAFRHHIPDTDLKKSFITRLKNLKDNNTESFNSYAFYAYDSVWLAAHALDVFLNEGENISFSSD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_463051

• Blastp: Glutamate receptor 3.4 from Arabidopsis with 69.05% of identity
• Blastx: Glutamate receptor 3.4 from Arabidopsis with 69.14% of identity
• Eggnog: PBPe(ENOG410ZZ8P)
• Kegg: Link to kegg annotations (AT1G05200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453770.1)
• Pfam: Receptor family ligand binding region (PF01094.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;