Transcript | Ll_transcript_463063 |
---|---|
CDS coordinates | 751-1506 (+) |
Peptide sequence | MKNEVVAAVGPQSSGIAHVVSHVANELHVPLLSFGATDPTLSALQYPYFIRTTQSDYYQMHAIADFIEYHGWREVIAIFVDDDNGRNGVTALGDALSKKRSRISYKAAFPPEASQSYISDLLNEVNLMESRVYVLHVNPDSGLTIFSIAKKLRMMSTGYVWIATDWLPSMLDSLVRADTGTMNILQGVVAFRHHIPDTDLKKSFITRLKNLKDNNTESFNSYAFYAYDSVWLAAHALDVFLNEGENISFSSD |
ORF Type | 3prime_partial |
Blastp | Glutamate receptor 3.4 from Arabidopsis with 69.05% of identity |
---|---|
Blastx | Glutamate receptor 3.4 from Arabidopsis with 69.14% of identity |
Eggnog | PBPe(ENOG410ZZ8P) |
Kegg | Link to kegg annotations (AT1G05200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453770.1) |
Pfam | Receptor family ligand binding region (PF01094.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer