Protein coding transcript 127284

• Transcript: Ll_transcript_492418
• CDS coordinates: 1426-1743 (+)
• Peptide sequence: MSCSLGARMGMWSYAQDCSKRRQPPTSFCSFIVAARQRPRYKIANTVDPQLYSKVSDKSSSNGRYIKWIRDPDVSGSKNPPIILRMKARACCSTTSSSASSGSCW*
• ORF Type: complete

Annotations of Ll_transcript_492418

• Blastp: Protein MAIN-LIKE 2 from Arabidopsis with 41.01% of identity
• Blastx: Protein MAIN-LIKE 2 from Arabidopsis with 41.01% of identity
• Eggnog: Serine threonine-protein phosphatase 7 long form(ENOG410YC97)
• Kegg: Link to kegg annotations (AT2G04865)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432591.1)
• Pfam: Plant mobile domain (PF10536.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;