Protein coding transcript 127340

• Transcript: Ll_transcript_492991
• CDS coordinates: 2-922 (+)
• Peptide sequence: TLGKVNHFPYGKDFPGHVPTGRSSNGKLVTDLLASYLNIKDYVPPFLDPNLSNDQLLTGVCFASGGAGFDDFTSVSLGGGAISMLNQLELFKVYVTKLKGIVGEDKAVQILGDALVVISAGTNDFVNNFYDTPTRKMMFNMDMYQDFLQYKLQIFIQDLYDLGCRKFGIGGLPPIGCLPAQITLKHSMDRKCVEDENSDSKLYNLKLIERLPQIQALLPGSRLVYGDIYGPLINLITQHEKYGLEITNRGCCGTGLIEAATLCTELTPVCNDASKYVFWDSLHVTEVTNQYIAKYLETQALPQFQI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_492991

• Blastp: GDSL esterase/lipase At2g30220 from Arabidopsis with 50.67% of identity
• Blastx: GDSL esterase/lipase At2g30220 from Arabidopsis with 50.67% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT2G30220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456189.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;