Transcript | Ll_transcript_493005 |
---|---|
CDS coordinates | 2-922 (+) |
Peptide sequence | TLGKVNHFPYGKDFPGHVPTGRSSNGKLVTDLLASYLNIKDYVPPFLDPNLSNDQLLTGVCFASGGAGFDDFTSVSLGGGAISMLNQLELFKVYVTKLKGIVGEDKAVQILGDALVVISAGTNDFVNNFYDTPTRKMMFNMDMYQDFLQYKLQIFIQDLYDLGCRKFGIGGLPPIGCLPAQITLKHSMDRKCVEDENSDSKLYNLKLIERLPQIQALLPGSRLVYGDIYGPLINLITQHEKYGLEITNRGCCGTGLIEAATLCTELTPVCNDASKYVFWDSLHVTEVTNQYIAKYLETQALPQFQI* |
ORF Type | 5prime_partial |
Blastp | GDSL esterase/lipase At2g30220 from Arabidopsis with 50.67% of identity |
---|---|
Blastx | GDSL esterase/lipase At2g30220 from Arabidopsis with 50.67% of identity |
Eggnog | GDSL esterase lipase(COG3240) |
Kegg | Link to kegg annotations (AT2G30220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456189.1) |
Pfam | GDSL-like Lipase/Acylhydrolase (PF00657.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer