Protein coding transcript 127715

• Transcript: Ll_transcript_493070
• CDS coordinates: 2038-2388 (+)
• Peptide sequence: MMNFLSQGYSPLGSPGVLKSDILKNPAISVVAEKLGKSPAQVALRWGLQTGHSVLPKSTSEARIKENFDVFDWSIPEDLIAKISEIKQDRLIKGTGFVHETYGFYKTIEELWDGEQ*
• ORF Type: complete

Annotations of Ll_transcript_493070

• Blastp: NADPH-dependent aldo-keto reductase, chloroplastic from Arabidopsis with 72.73% of identity
• Blastx: NADPH-dependent aldo-keto reductase, chloroplastic from Arabidopsis with 72.73% of identity
• Eggnog: reductase(COG0656)
• Kegg: Link to kegg annotations (AT2G37770)
• CantataDB: Link to cantataDB annotations (CNT0001532)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430790.1)
• Pfam: Aldo/keto reductase family (PF00248.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;