Protein coding transcript 1279

• Transcript: Ll_transcript_478853
• CDS coordinates: 124-495 (+)
• Peptide sequence: MANSSDNGTVFVYHDSSWFLKVCVKDDRPVGSPGMFYDDNPFDYVLPVTLCQIFIHNILSRLFSFLLQPIRTPKFICNVIAGIVLGPSGLGLNQRYFNVLFPARQTEFLQLASLIGTSYYVFVI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_478853

• Blastp: Cation/H(+) antiporter 18 from Arabidopsis with 41.77% of identity
• Blastx: Cation/H(+) antiporter 18 from Arabidopsis with 41.77% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT5G41610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437573.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;