Protein coding transcript 127984

• Transcript: Ll_transcript_494399
• CDS coordinates: 1-333 (+)
• Peptide sequence: CLPVKGGEDQPLGYVKTFKTKHEQYLVIIYDLDKITKGDDQPRIGLASRHKINEDWMRSKFLGFLVHSAPEACMLPSQSCKSPGKVLPNLAPTYPLLCQHPLASAPRPLH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_494399

• Blastp: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 26.58% of identity
• Blastx: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 26.58% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YIL082W-A)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432977.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;