Protein coding transcript 129694

• Transcript: Ll_transcript_364555
• CDS coordinates: 1-297 (+)
• Peptide sequence: EKPETEKMKHTTFLFGILALWSALSVIAEDRYQFFTWEVTQGTISPLGVPQQGILINGQFPSPTIEAITNDNIVVNVINKLDEAFLITWSGIKQRRTSW
• ORF Type: internal

Annotations of Ll_transcript_364555

• Blastp: Monocopper oxidase-like protein SKU5 from Arabidopsis with 56.18% of identity
• Blastx: L-ascorbate oxidase homolog from Nicotiana with 62.35% of identity
• Eggnog: Multicopper oxidase(COG2132)
• Kegg: Link to kegg annotations (AT4G12420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433262.1)
• Pfam: Multicopper oxidase (PF07732.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;