Transcript | Ll_transcript_364555 |
---|---|
CDS coordinates | 1-297 (+) |
Peptide sequence | EKPETEKMKHTTFLFGILALWSALSVIAEDRYQFFTWEVTQGTISPLGVPQQGILINGQFPSPTIEAITNDNIVVNVINKLDEAFLITWSGIKQRRTSW |
ORF Type | internal |
Blastp | Monocopper oxidase-like protein SKU5 from Arabidopsis with 56.18% of identity |
---|---|
Blastx | L-ascorbate oxidase homolog from Nicotiana with 62.35% of identity |
Eggnog | Multicopper oxidase(COG2132) |
Kegg | Link to kegg annotations (AT4G12420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433262.1) |
Pfam | Multicopper oxidase (PF07732.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer