Protein coding transcript 129697

• Transcript: Ll_transcript_361565
• CDS coordinates: 175-693 (+)
• Peptide sequence: MLQETHYEVLNVKEDSSYDEIRTSYRSAVLSLHPDKLLSTSETSSVNQRSGDRFLKVQKAWEILSNSSSRLSYDNELRNSRQDILAAEVAEDLSLDDMAVEDDGEALELFYQCRCGDYFSVDSFELQQMGYSLLREGSTISALNVDALPGSVILPCGSCSLKARLVINVYDN*
• ORF Type: complete

Annotations of Ll_transcript_361565

• Blastp: Diphthamide biosynthesis protein 4 from Saccharomyces with 34.84% of identity
• Blastx: Diphthamide biosynthesis protein 4 from Saccharomyces with 34.84% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YJR097W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437864.1)
• Pfam: DnaJ domain (PF00226.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;